Class b: All beta proteins [48724] (177 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (15 species) not a true protein |
Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries) |
Domain d4gdia_: 4gdi A: [202241] automated match to d4gdib_ complexed with ca, gol, nag, no3 |
PDB Entry: 4gdi (more details), 1.95 Å
SCOPe Domain Sequences for d4gdia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gdia_ b.68.1.0 (A:) automated matches {Influenza A virus [TaxId: 11320]} fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv qninwds
Timeline for d4gdia_: