Lineage for d4gdaa_ (4gda A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1325092Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1325093Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1325094Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1325401Protein automated matches [190191] (2 species)
    not a true protein
  7. 1325474Species Streptomyces avidinii [TaxId:1895] [189343] (24 PDB entries)
  8. 1325475Domain d4gdaa_: 4gda A: [202240]
    automated match to d4gdab_
    complexed with btn, eoh, gol, so4

Details for d4gdaa_

PDB Entry: 4gda (more details), 1 Å

PDB Description: circular permuted streptavidin a50/n49
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d4gdaa_:

Sequence, based on SEQRES records: (download)

>d4gdaa_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
aesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwl
ltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadga
ltgtyesavgn

Sequence, based on observed residues (ATOM records): (download)

>d4gdaa_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
aesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwl
ltsgtteanawkstlvghdtftkvkpsaeagitgtwynqlgstfivtagadgaltgtyes
avgn

SCOPe Domain Coordinates for d4gdaa_:

Click to download the PDB-style file with coordinates for d4gdaa_.
(The format of our PDB-style files is described here.)

Timeline for d4gdaa_: