Lineage for d1gpol1 (1gpo L:1-112)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652981Species Engineered (including hybrid species) [88533] (52 PDB entries)
  8. 652992Domain d1gpol1: 1gpo L:1-112 [20224]
    Other proteins in same PDB: d1gpoh1, d1gpoh2, d1gpoi1, d1gpoi2, d1gpol2, d1gpom2

Details for d1gpol1

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment
PDB Compounds: (L:) antibody m41

SCOP Domain Sequences for d1gpol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpol1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleik

SCOP Domain Coordinates for d1gpol1:

Click to download the PDB-style file with coordinates for d1gpol1.
(The format of our PDB-style files is described here.)

Timeline for d1gpol1: