SCOP 1.55: Domain d1gpol1: 1gpo L:1-112

Lineage for d1gpol1 (1gpo L:1-112)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab M41 (artificial design) [48845] (1 PDB entry)

8. Domain d1gpol1: 1gpo L:1-112 [20224]
   Other proteins in same PDB: d1gpoh2, d1gpoi2, d1gpol2, d1gpom2

Details for d1gpol1

PDB Entry: 1gpo, 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpol1:

Sequence; same for both SEQRES and ATOM records:

>d1gpol1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Fab M41 (artificial design)}
dieltqspatlsvtpgnsvsiscrasqslvnedgntylfwyqqkshesprllikyasqsi
sgipsrfsgsgsgtdftlsinsvetedlavyfcqqitdwpftfgggtkleik

Timeline for d1gpol1:

• d1gpol1 appears in SCOP 1.57
  
• d1gpol1 appears in the current release, SCOPe 2.07