Lineage for d4gd9c_ (4gd9 C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063930Protein automated matches [190191] (2 species)
    not a true protein
  7. 2064009Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)
  8. 2064043Domain d4gd9c_: 4gd9 C: [202238]
    automated match to d4gd9b_
    complexed with btn, so4

Details for d4gd9c_

PDB Entry: 4gd9 (more details), 1.5 Å

PDB Description: circular permuted streptavidin n49/g48
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d4gd9c_:

Sequence, based on SEQRES records: (download)

>d4gd9c_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
naesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqw
lltsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadg
altgtyesavg

Sequence, based on observed residues (ATOM records): (download)

>d4gd9c_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
naesryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqw
lltsgtteanawkstlvghdtftkvksaeagitgtwynqlgstfivtagadgaltgtyes
avg

SCOPe Domain Coordinates for d4gd9c_:

Click to download the PDB-style file with coordinates for d4gd9c_.
(The format of our PDB-style files is described here.)

Timeline for d4gd9c_: