Lineage for d4gamm_ (4gam M:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1726377Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 1726410Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
    duplication: consists of two domains of this fold
    automatically mapped to Pfam PF02964
  5. 1726411Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 1726412Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 1726413Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)
  8. 1726466Domain d4gamm_: 4gam M: [202232]
    Other proteins in same PDB: d4gama_, d4gamb_, d4gamd_, d4gamf_, d4gamg_, d4gami_, d4gamk_, d4gaml_, d4gamn_, d4gamp_, d4gamq_, d4gams_
    automated match to d1fz1e_
    complexed with fe

Details for d4gamm_

PDB Entry: 4gam (more details), 2.9 Å

PDB Description: Complex structure of Methane monooxygenase hydroxylase and regulatory subunit
PDB Compounds: (M:) Methane monooxygenase component A gamma chain

SCOPe Domain Sequences for d4gamm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gamm_ a.23.3.1 (M:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

SCOPe Domain Coordinates for d4gamm_:

Click to download the PDB-style file with coordinates for d4gamm_.
(The format of our PDB-style files is described here.)

Timeline for d4gamm_: