SCOP 1.63: Domain d1jrhh1: 1jrh H:1-113

Lineage for d1jrhh1 (1jrh H:1-113)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab A6 (mouse), kappa L chain [48844] (1 PDB entry)

8. Domain d1jrhh1: 1jrh H:1-113 [20223]
   Other proteins in same PDB: d1jrhh2, d1jrhi_, d1jrhl2
   mutant

Details for d1jrhh1

PDB Entry: 1jrh, 2.8 Å

PDB Description: complex (antibody/antigen)

SCOP Domain Sequences for d1jrhh1:

Sequence; same for both SEQRES and ATOM records:

>d1jrhh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab A6 (mouse), kappa L chain}
avklqesgpgilkpsqtlsltcsfsgfslttygmgvgwirqssgkglewlahiwwdddky
ynpslksrltiskdtsrnqvflkitsvatadtatyycarrapfygnhamdywgqgttvtv
ss

Timeline for d1jrhh1:

• d1jrhh1 first appeared (with stable ids) in SCOP 1.55
  
• d1jrhh1 appears in SCOP 1.61
  
• d1jrhh1 appears in SCOP 1.65
  
• d1jrhh1 appears in the current release, SCOPe 2.08