![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily) corner-like structure formed by two sheets and filled in with 2-3 helices |
![]() | Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) ![]() duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold |
![]() | Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins) note: the solution structure determinations disagree in the relative orientations of two motifs |
![]() | Protein Soluble methane monooxygenase regulatory protein B [56031] (3 species) |
![]() | Species Methylococcus capsulatus [TaxId:243233] [194030] (1 PDB entry) |
![]() | Domain d4gami_: 4gam I: [202229] Other proteins in same PDB: d4gama_, d4gamb_, d4gamc_, d4gamf_, d4gamg_, d4gamh_, d4gamk_, d4gaml_, d4gamm_, d4gamp_, d4gamq_, d4gamr_ automated match to d1ckva_ complexed with fe |
PDB Entry: 4gam (more details), 2.9 Å
SCOPe Domain Sequences for d4gami_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gami_ d.137.1.1 (I:) Soluble methane monooxygenase regulatory protein B {Methylococcus capsulatus [TaxId: 243233]} svnsnaydagimglkgkdfadqffadenqvvhesdtvvlvlkksdeintfieeilltdyk knvnptvnvedragywwikangkievdcdeisellgrqfnvydflvdvsstigraytlgn kftitselmgld
Timeline for d4gami_: