Lineage for d4gamf_ (4gam F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990319Protein automated matches [190435] (11 species)
    not a true protein
  7. 1990403Species Methylococcus capsulatus [TaxId:243233] [226584] (1 PDB entry)
  8. 1990405Domain d4gamf_: 4gam F: [202226]
    Other proteins in same PDB: d4gamb_, d4gamc_, d4gamd_, d4gamg_, d4gamh_, d4gami_, d4gaml_, d4gamm_, d4gamn_, d4gamq_, d4gamr_, d4gams_
    automated match to d1fz1a_
    complexed with fe

Details for d4gamf_

PDB Entry: 4gam (more details), 2.9 Å

PDB Description: Complex structure of Methane monooxygenase hydroxylase and regulatory subunit
PDB Compounds: (F:) Methane monooxygenase component A alpha chain

SCOPe Domain Sequences for d4gamf_:

Sequence, based on SEQRES records: (download)

>d4gamf_ a.25.1.2 (F:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
derqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwnrwvyedwg
giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
tlrvheyngqmhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
liaqphvrgdklwtlddikrlncvfknpvkaf

Sequence, based on observed residues (ATOM records): (download)

>d4gamf_ a.25.1.2 (F:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
derqfgslqdaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwnrwvyedwg
giwigrlgygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfean
ypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgast
lrvheyngqmhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgktl
iaqphvrgdklwtlddikrlncvfknpvkaf

SCOPe Domain Coordinates for d4gamf_:

Click to download the PDB-style file with coordinates for d4gamf_.
(The format of our PDB-style files is described here.)

Timeline for d4gamf_: