SCOPe 2.05: Domain d4gafb3: 4gaf B:208-313

Lineage for d4gafb3 (4gaf B:208-313)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Type-1 interleukin-1 receptor [49177] (1 species)
   duplication: tandem repeat of 3 domains

7. Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries)

8. Domain d4gafb3: 4gaf B:208-313 [202221]
   Other proteins in same PDB: d4gafa_
   automated match to d1iray3
   complexed with na, nag

Details for d4gafb3

PDB Entry: 4gaf, 2.15 Å

PDB Description: crystal structure of ebi-005, a chimera of human il-1beta and il-1ra, bound to human interleukin-1 receptor type 1

PDB Compounds: (B:) Interleukin-1 receptor type 1

SCOPe Domain Sequences for d4gafb3:

Sequence; same for both SEQRES and ATOM records:

>d4gafb3 b.1.1.4 (B:208-313) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
rpvivspanetmevdlgsqiqlicnvtgqlsdiaywkwngsvideddpvlgedyysvenp
ankrrstlitvlniseiesrfykhpftcfaknthgidaayiqliyp

Timeline for d4gafb3:

• d4gafb3 first appeared in SCOPe 2.03
  
• d4gafb3 appears in SCOPe 2.04
  
• d4gafb3 appears in SCOPe 2.06
  
• d4gafb3 appears in the current release, SCOPe 2.08