| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Type-1 interleukin-1 receptor [49177] (1 species) duplication: tandem repeat of 3 domains |
| Species Human (Homo sapiens) [TaxId:9606] [49178] (4 PDB entries) |
| Domain d4gafb1: 4gaf B:4-104 [202219] Other proteins in same PDB: d4gafa_ automated match to d1iray1 complexed with na, nag |
PDB Entry: 4gaf (more details), 2.15 Å
SCOPe Domain Sequences for d4gafb1:
Sequence, based on SEQRES records: (download)
>d4gafb1 b.1.1.4 (B:4-104) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
dkckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkek
lwfvpakvedsghyycvvrnssyclrikisakfvenepnlc
>d4gafb1 b.1.1.4 (B:4-104) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
dkckereekiilvssaneidvrpcplnpnehkgtitwykddsktpvsteqasrihqhkek
lwfvpakvedsghyycvvyclrikisakfvenepnlc
Timeline for d4gafb1: