Lineage for d4g81d_ (4g81 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108700Species Salmonella enterica [TaxId:550537] [194806] (1 PDB entry)
  8. 2108704Domain d4g81d_: 4g81 D: [202218]
    automated match to d4g81c_
    complexed with cl, edo, gol

Details for d4g81d_

PDB Entry: 4g81 (more details), 1.9 Å

PDB Description: Crystal structure of a hexonate dehydrogenase ortholog (target efi-506402 from salmonella enterica, unliganded structure
PDB Compounds: (D:) Putative hexonate dehydrogenase

SCOPe Domain Sequences for d4g81d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g81d_ c.2.1.0 (D:) automated matches {Salmonella enterica [TaxId: 550537]}
alfdltgktalvtgsarglgfayaeglaaagarvilndiratllaesvdtltrkgydahg
vafdvtdelaieaafskldaegihvdilinnagiqyrkpmvelelenwqkvidtnltsaf
lvsrsaakrmiarnsggkiinigsltsqaarptvapytaakggikmltcsmaaewaqfni
qtnaigpgyiltdmntaliedkqfdswvksstpsqrwgrpeeligtaiflsskasdying
qiiyvdggwlavl

SCOPe Domain Coordinates for d4g81d_:

Click to download the PDB-style file with coordinates for d4g81d_.
(The format of our PDB-style files is described here.)

Timeline for d4g81d_: