SCOPe 2.06: Domain d1ahwe1: 1ahw E:1-117

Lineage for d1ahwe1 (1ahw E:1-117)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

Domain d1ahwe1: 1ahw E:1-117 [20221]
Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwd2, d1ahwe2, d1ahwf1, d1ahwf2
part of anti-human tissue factor Fab 5G9

Details for d1ahwe1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

PDB Compounds: (E:) immunoglobulin fab 5g9 (heavy chain)

SCOPe Domain Sequences for d1ahwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwe1 b.1.1.1 (E:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvss

SCOPe Domain Coordinates for d1ahwe1:

Click to download the PDB-style file with coordinates for d1ahwe1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwe1: