SCOP 1.67: Domain d1ahwe1: 1ahw E:1-117

Lineage for d1ahwe1 (1ahw E:1-117)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (28 PDB entries)

8. Domain d1ahwe1: 1ahw E:1-117 [20221]
   Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd1, d1ahwd2, d1ahwe2, d1ahwf1, d1ahwf2
   part of anti-human tissue factor Fab 5G9

Details for d1ahwe1

PDB Entry: 1ahw, 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwe1:

Sequence; same for both SEQRES and ATOM records:

>d1ahwe1 b.1.1.1 (E:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1}
eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvss

Timeline for d1ahwe1:

• d1ahwe1 first appeared (with stable ids) in SCOP 1.55
  
• d1ahwe1 appears in SCOP 1.65
  
• d1ahwe1 appears in SCOP 1.69
  
• d1ahwe1 appears in the current release, SCOPe 2.08