| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [48843] (2 PDB entries) |
| Domain d1ahwe1: 1ahw E:1-117 [20221] Other proteins in same PDB: d1ahwa2, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd2, d1ahwe2, d1ahwf1, d1ahwf2 |
PDB Entry: 1ahw (more details), 3 Å
SCOP Domain Sequences for d1ahwe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahwe1 b.1.1.1 (E:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain}
eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvss
Timeline for d1ahwe1: