Lineage for d1ahwe1 (1ahw E:1-117)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219094Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [48843] (2 PDB entries)
  8. 219100Domain d1ahwe1: 1ahw E:1-117 [20221]
    Other proteins in same PDB: d1ahwa2, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd2, d1ahwe2, d1ahwf1, d1ahwf2

Details for d1ahwe1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwe1 b.1.1.1 (E:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain}
eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvss

SCOP Domain Coordinates for d1ahwe1:

Click to download the PDB-style file with coordinates for d1ahwe1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwe1: