SCOP 1.59: Domain d1ahwe1: 1ahw E:1-117

Lineage for d1ahwe1 (1ahw E:1-117)

Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [48843] (2 PDB entries)
Domain d1ahwe1: 1ahw E:1-117 [20221]
Other proteins in same PDB: d1ahwa2, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd2, d1ahwe2, d1ahwf1, d1ahwf2

Details for d1ahwe1

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwe1 b.1.1.1 (E:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain}
eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvss

SCOP Domain Coordinates for d1ahwe1:

Click to download the PDB-style file with coordinates for d1ahwe1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwe1: