Lineage for d4g7hn_ (4g7h N:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574381Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 2574387Species Thermus thermophilus [TaxId:274] [75610] (15 PDB entries)
    Uniprot Q8RQE8; part of multichain biological unit
  8. 2574389Domain d4g7hn_: 4g7h N: [202204]
    Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7he_, d4g7hf1, d4g7hf2, d4g7hf3, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7ho_, d4g7hp1, d4g7hp2, d4g7hp3
    automated match to d1smyd_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7hn_

PDB Entry: 4g7h (more details), 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex
PDB Compounds: (N:) DNA-directed RNA polymerase subunit beta'

SCOPe Domain Sequences for d4g7hn_:

Sequence, based on SEQRES records: (download)

>d4g7hn_ e.29.1.2 (N:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkdg
eevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgeil
aelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekgq
plaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarve
agdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvla
dggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemk
hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrs
ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
ekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
rdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyv
fanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliql
dvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkq
yleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyv
maqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
dtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradiea
glygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcq
kcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprviel
fearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyveag
qpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvevt
dpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfqn
tthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearkea

Sequence, based on observed residues (ATOM records): (download)

>d4g7hn_ e.29.1.2 (N:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkdg
eevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgeil
aelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekgq
plaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarve
agdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvla
dggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemk
hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrs
ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
ekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
rdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyv
fanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliql
dvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkq
yleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyv
maqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
dtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradiea
glygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcq
kcygydlsmarpvsigeavgivaaqsigepgtqltitqglprvielfearrpkakavise
idgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyveagqpltrgaidphqll
eakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvevtdpgdsrllegqvle
kwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkk
deliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearkea

SCOPe Domain Coordinates for d4g7hn_:

Click to download the PDB-style file with coordinates for d4g7hn_.
(The format of our PDB-style files is described here.)

Timeline for d4g7hn_: