Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus thermophilus [TaxId:274] [75595] (14 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d4g7hk2: 4g7h K:50-172 [202201] Other proteins in same PDB: d4g7ha1, d4g7hb1, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf1, d4g7hf2, d4g7hf3, d4g7hk1, d4g7hl1, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp1, d4g7hp2, d4g7hp3 automated match to d1smya2 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7h (more details), 2.9 Å
SCOPe Domain Sequences for d4g7hk2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7hk2 d.181.1.1 (K:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda vfs
Timeline for d4g7hk2: