Lineage for d4g7he_ (4g7h E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017141Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2017142Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2017143Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2017144Protein RNA polymerase omega subunit [63564] (3 species)
  7. 2017149Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries)
  8. 2017150Domain d4g7he_: 4g7h E: [202199]
    Other proteins in same PDB: d4g7ha1, d4g7ha2, d4g7hb1, d4g7hb2, d4g7hc_, d4g7hd_, d4g7hf1, d4g7hf2, d4g7hf3, d4g7hk1, d4g7hk2, d4g7hl1, d4g7hl2, d4g7hm_, d4g7hn_, d4g7hp1, d4g7hp2, d4g7hp3
    automated match to d2o5ie_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7he_

PDB Entry: 4g7h (more details), 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d4g7he_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7he_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

SCOPe Domain Coordinates for d4g7he_:

Click to download the PDB-style file with coordinates for d4g7he_.
(The format of our PDB-style files is described here.)

Timeline for d4g7he_: