Lineage for d4g7ha2 (4g7h A:50-172)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004951Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 3004952Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 3004953Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 3004954Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 3004969Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 3004970Domain d4g7ha2: 4g7h A:50-172 [202195]
    Other proteins in same PDB: d4g7ha1, d4g7hb1, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf1, d4g7hf2, d4g7hf3, d4g7hk1, d4g7hl1, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp1, d4g7hp2, d4g7hp3
    automated match to d1smya2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7ha2

PDB Entry: 4g7h (more details), 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d4g7ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g7ha2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d4g7ha2:

Click to download the PDB-style file with coordinates for d4g7ha2.
(The format of our PDB-style files is described here.)

Timeline for d4g7ha2: