SCOPe 2.08: Domain d4g7ha2: 4g7h A:50-172

Lineage for d4g7ha2 (4g7h A:50-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d4g7ha2: 4g7h A:50-172 [202195]
   Other proteins in same PDB: d4g7ha1, d4g7hb1, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf1, d4g7hf2, d4g7hf3, d4g7hk1, d4g7hl1, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp1, d4g7hp2, d4g7hp3
   automated match to d1smya2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7ha2

PDB Entry: 4g7h, 2.9 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex

PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d4g7ha2:

Sequence; same for both SEQRES and ATOM records:

>d4g7ha2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d4g7ha2:

• d4g7ha2 first appeared in SCOPe 2.03
  
• d4g7ha2 appears in SCOPe 2.07