Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
Protein RNA polymerase alpha [55259] (3 species) |
Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
Domain d4g7ha1: 4g7h A:4-49,A:173-229 [202194] Other proteins in same PDB: d4g7ha2, d4g7hb2, d4g7hc_, d4g7hd_, d4g7he_, d4g7hf1, d4g7hf2, d4g7hf3, d4g7hk2, d4g7hl2, d4g7hm_, d4g7hn_, d4g7ho_, d4g7hp1, d4g7hp2, d4g7hp3 automated match to d1smya1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7h (more details), 2.9 Å
SCOPe Domain Sequences for d4g7ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7ha1 d.74.3.1 (A:4-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]} sklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtr lgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d4g7ha1: