Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (24 species) not a true protein |
Species Leishmania major [TaxId:347515] [194809] (2 PDB entries) |
Domain d4g5db_: 4g5d B: [202193] automated match to d4g5da_ complexed with ndp |
PDB Entry: 4g5d (more details), 1.8 Å
SCOPe Domain Sequences for d4g5db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g5db_ c.1.7.0 (B:) automated matches {Leishmania major [TaxId: 347515]} gvdkamvtlsngvkmpqfglgvwqspagevtenavkwalcagyrhidtaaiykneesvga glrasgvpredvfittklwnteqgyestlaafeesrqklgvdyidlylihwprgkdilsk egkkyldswrafeqlykekkvraigvsnfhihhledvlamctvtpmvnqvelhplnnqad lrafcdakqikveawsplgqgkllsnpilsaigakynktaaqvilrwniqknlitipksv hrerieenadifdfelgaedvmsidalntnsrygpdpdeaqf
Timeline for d4g5db_: