Lineage for d4g5db_ (4g5d B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1818041Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 1818042Protein automated matches [190793] (24 species)
    not a true protein
  7. 1818116Species Leishmania major [TaxId:347515] [194809] (2 PDB entries)
  8. 1818120Domain d4g5db_: 4g5d B: [202193]
    automated match to d4g5da_
    complexed with ndp

Details for d4g5db_

PDB Entry: 4g5d (more details), 1.8 Å

PDB Description: x-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to nadph
PDB Compounds: (B:) Prostaglandin f2-alpha synthase/D-arabinose dehydrogenase

SCOPe Domain Sequences for d4g5db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g5db_ c.1.7.0 (B:) automated matches {Leishmania major [TaxId: 347515]}
gvdkamvtlsngvkmpqfglgvwqspagevtenavkwalcagyrhidtaaiykneesvga
glrasgvpredvfittklwnteqgyestlaafeesrqklgvdyidlylihwprgkdilsk
egkkyldswrafeqlykekkvraigvsnfhihhledvlamctvtpmvnqvelhplnnqad
lrafcdakqikveawsplgqgkllsnpilsaigakynktaaqvilrwniqknlitipksv
hrerieenadifdfelgaedvmsidalntnsrygpdpdeaqf

SCOPe Domain Coordinates for d4g5db_:

Click to download the PDB-style file with coordinates for d4g5db_.
(The format of our PDB-style files is described here.)

Timeline for d4g5db_: