Lineage for d4g4ek_ (4g4e K:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224776Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 2224792Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)
  8. 2224807Domain d4g4ek_: 4g4e K: [202181]
    automated match to d4g4ee_
    mutant

Details for d4g4ek_

PDB Entry: 4g4e (more details), 2.89 Å

PDB Description: crystal structure of the l88a mutant of hslv from escherichia coli
PDB Compounds: (K:) ATP-dependent protease subunit HslV

SCOPe Domain Sequences for d4g4ek_:

Sequence, based on SEQRES records: (download)

>d4g4ek_ d.153.1.4 (K:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmarkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

Sequence, based on observed residues (ATOM records): (download)

>d4g4ek_ d.153.1.4 (K:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrrkleallavadetasliitgngdvvqpendliaigsg
gpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOPe Domain Coordinates for d4g4ek_:

Click to download the PDB-style file with coordinates for d4g4ek_.
(The format of our PDB-style files is described here.)

Timeline for d4g4ek_: