Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [48843] (2 PDB entries) |
Domain d1ahwa1: 1ahw A:1-108 [20218] Other proteins in same PDB: d1ahwa2, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd2, d1ahwe2, d1ahwf1, d1ahwf2 |
PDB Entry: 1ahw (more details), 3 Å
SCOP Domain Sequences for d1ahwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahwa1 b.1.1.1 (A:1-108) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain} dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinr
Timeline for d1ahwa1: