Lineage for d4fzwd_ (4fzw D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. Protein automated matches [190246] (70 species)
    not a true protein
  7. Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries)
  8. Domain d4fzwd_: 4fzw D: [202168]
    Other proteins in same PDB: d4fzwb2
    automated match to d4fzwc_
    complexed with gol

Details for d4fzwd_

PDB Entry: 4fzw (more details), 2.55 Å

PDB Description: crystal structure of the paaf-paag hydratase-isomerase complex from e.coli
PDB Compounds: (D:) 1,2-epoxyphenylacetyl-CoA isomerase

SCOPe Domain Sequences for d4fzwd_:

Sequence, based on SEQRES records: (download)

>d4fzwd_ c.14.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
filshvekgvmtltlnrperlnsfndemhaqlaeclkqverddtircllltgagrgfcag
qdlndrnvdptgpapdlgmsverfynplvrrlaklpkpvicavngvaagagatlalggdi
viaarsakfvmafsklglipdcggtwllprvagraramglallgnqlsaeqahewgmiwq
vvddetladtaqqlarhlatqptfglglikqainsaetntldtqldlerdyqrlagrsad
yregvsaflakrspqftgk

Sequence, based on observed residues (ATOM records): (download)

>d4fzwd_ c.14.1.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
filshvekgvmtltlnrperlnsfndemhaqlaeclkqverddtircllltgagrgfcag
qdlnapdlgmsverfynplvrrlaklpkpvicavngvaagagatlalggdiviaarsakf
vmafsklglipdcggtwllprvagraramglallgnqlsaeqahewgmiwqvvddetlad
taqqlarhlatqptfglglikqainsaetntldtqldlerdyqrlagrsadyregvsafl
akrspqftgk

SCOPe Domain Coordinates for d4fzwd_ are not available.

Timeline for d4fzwd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4fzwa_, d4fzwb1, d4fzwb2, d4fzwc_