Lineage for d1fgnl1 (1fgn L:1-108)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783226Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (182 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7
    SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region)
    SQ NA # humanized antibody
    SQ NA # part of Fab 28 against HIV-1 RT
    Uniprot P01642 21-115 #
    KV5I_MOUSE Ig kappa chain V-V region L7 precursor
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 783362Domain d1fgnl1: 1fgn L:1-108 [20216]
    Other proteins in same PDB: d1fgnh1, d1fgnh2, d1fgnl2
    part of anti-human tissue factor Fab 5G9

Details for d1fgnl1

PDB Entry: 1fgn (more details), 2.5 Å

PDB Description: monoclonal murine antibody 5g9-anti-human tissue factor
PDB Compounds: (L:) immunoglobulin fab 5g9

SCOP Domain Sequences for d1fgnl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgnl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinr

SCOP Domain Coordinates for d1fgnl1:

Click to download the PDB-style file with coordinates for d1fgnl1.
(The format of our PDB-style files is described here.)

Timeline for d1fgnl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgnl2