SCOP 1.71: Domain d1fgnl1: 1fgn L:1-108

Lineage for d1fgnl1 (1fgn L:1-108)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (170 PDB entries)

8. Domain d1fgnl1: 1fgn L:1-108 [20216]
   Other proteins in same PDB: d1fgnh1, d1fgnh2, d1fgnl2
   part of anti-human tissue factor Fab 5G9

Details for d1fgnl1

PDB Entry: 1fgn, 2.5 Å

PDB Description: monoclonal murine antibody 5g9-anti-human tissue factor

SCOP Domain Sequences for d1fgnl1:

Sequence; same for both SEQRES and ATOM records:

>d1fgnl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinr

Timeline for d1fgnl1:

• d1fgnl1 first appeared (with stable ids) in SCOP 1.55
  
• d1fgnl1 appears in SCOP 1.69
  
• d1fgnl1 appears in SCOP 1.73
  
• d1fgnl1 appears in the current release, SCOPe 2.08