Lineage for d1fgnl1 (1fgn L:1-108)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7463Species Fab 5G9 (mouse), kappa L chain [48843] (2 PDB entries)
  8. 7465Domain d1fgnl1: 1fgn L:1-108 [20216]
    Other proteins in same PDB: d1fgnh2, d1fgnl2

Details for d1fgnl1

PDB Entry: 1fgn (more details), 2.5 Å

PDB Description: monoclonal murine antibody 5g9-anti-human tissue factor
PDB Compounds: (L:)

SCOP Domain Sequences for d1fgnl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgnl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 5G9 (mouse), kappa L chain}
dikmtqspssmyaslgervtitckasqdirkylnwyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespytfgggtkleinr

SCOP Domain Coordinates for d1fgnl1:

Click to download the PDB-style file with coordinates for d1fgnl1.
(The format of our PDB-style files is described here.)

Timeline for d1fgnl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgnl2