SCOPe 2.06: Domain d4fxpa_: 4fxp A:

Lineage for d4fxpa_ (4fxp A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [189883] (5 PDB entries)

8. Domain d4fxpa_: 4fxp A: [202145]
   automated match to d3uieb_
   complexed with adx, so4

Details for d4fxpa_

PDB Entry: 4fxp, 1.95 Å

PDB Description: Crystal structure of adenosine 5'-phosphosulfate kinase from Arabidopsis thaliana in Complex with Sulfate and APS

PDB Compounds: (A:) Adenylyl-sulfate kinase 1, chloroplastic

SCOPe Domain Sequences for d4fxpa_:

Sequence; same for both SEQRES and ATOM records:

>d4fxpa_ c.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ecsvekvdrqrlldqkgcviwvtglsgsgkstlacalnqmlyqkgklcyildgdnvrhgl
nrdlsfkaedraenirrvgevaklfadagiiciaslispyrtdrdacrsllpegdfvevf
mdvplsvceardpkglyklaragkikgftgiddpyepplnceislgreggtspiemaekv
vgyldnkgylqa

Timeline for d4fxpa_:

• d4fxpa_ first appeared in SCOPe 2.03
  
• d4fxpa_ appears in SCOPe 2.05
  
• d4fxpa_ appears in SCOPe 2.07
  
• d4fxpa_ appears in the current release, SCOPe 2.08