Lineage for d4furc_ (4fur C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928867Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2928868Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2928956Family d.8.1.0: automated matches [193589] (1 protein)
    not a true family
  6. 2928957Protein automated matches [193590] (3 species)
    not a true protein
  7. 2928958Species Brucella melitensis [TaxId:359391] [193591] (1 PDB entry)
  8. 2928961Domain d4furc_: 4fur C: [202137]
    automated match to d4furd_
    complexed with cl, edo

Details for d4furc_

PDB Entry: 4fur (more details), 2.1 Å

PDB Description: Crystal Structure of Urease subunit gamma 2 from Brucella melitensis biovar Abortus 2308
PDB Compounds: (C:) Urease subunit gamma 2

SCOPe Domain Sequences for d4furc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4furc_ d.8.1.0 (C:) automated matches {Brucella melitensis [TaxId: 359391]}
mhltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdga
rsvlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit

SCOPe Domain Coordinates for d4furc_:

Click to download the PDB-style file with coordinates for d4furc_.
(The format of our PDB-style files is described here.)

Timeline for d4furc_: