| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) ![]() |
| Family d.8.1.0: automated matches [193589] (1 protein) not a true family |
| Protein automated matches [193590] (3 species) not a true protein |
| Species Brucella melitensis [TaxId:359391] [193591] (1 PDB entry) |
| Domain d4furb_: 4fur B: [202136] automated match to d4furd_ complexed with cl, edo |
PDB Entry: 4fur (more details), 2.1 Å
SCOPe Domain Sequences for d4furb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4furb_ d.8.1.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
ltprefdklvihmlsdvalkrknkglklnhpeavavlsayvldgaregktveevmdgars
vlkaddvmdgvpdllpliqveavfsdgsrlvslhnpit
Timeline for d4furb_: