Lineage for d1ad9h1 (1ad9 H:1-113)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929502Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 929581Domain d1ad9h1: 1ad9 H:1-113 [20213]
    Other proteins in same PDB: d1ad9a1, d1ad9a2, d1ad9b2, d1ad9h2, d1ad9l1, d1ad9l2
    part of humanized Fab CTM01
    complexed with so4

Details for d1ad9h1

PDB Entry: 1ad9 (more details), 2.8 Å

PDB Description: igg-fab fragment of engineered human monoclonal antibody ctm01
PDB Compounds: (H:) igg ctm01 fab (heavy chain)

SCOPe Domain Sequences for d1ad9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad9h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
eiqlvqsgaevkkpgssvkvsckasgytftdyyinwmrqapgqglewigwidpgsgntky
nekfkgratltvdtstntaymelsslrsedtafyfcarekttyyyamdywgqgtlvtvss

SCOPe Domain Coordinates for d1ad9h1:

Click to download the PDB-style file with coordinates for d1ad9h1.
(The format of our PDB-style files is described here.)

Timeline for d1ad9h1: