Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species) |
Species Human (Homo sapiens), mitochondrial [TaxId:9606] [53726] (27 PDB entries) Uniprot P05091 |
Domain d4fr8a_: 4fr8 A: [202125] automated match to d4fr8h_ complexed with adp, btb, mg, na, nad, tng, ure |
PDB Entry: 4fr8 (more details), 2.2 Å
SCOPe Domain Sequences for d4fr8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fr8a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} vpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaar aafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvlk clryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatgn vvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgst eigrviqvaagssnlkrvtlqlggkspniimsdadmdwaveqahfalffnqgqscsagsr tfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegakl lcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstygl aaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayte vktvtvkvpqkns
Timeline for d4fr8a_: