| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
| Domain d4fqil1: 4fqi L:2-107 [202122] Other proteins in same PDB: d4fqia1, d4fqia2, d4fqib1, d4fqib2, d4fqil2 automated match to d2mcg11 complexed with edo, gol, nag |
PDB Entry: 4fqi (more details), 1.71 Å
SCOPe Domain Sequences for d4fqil1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fqil1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppavsgtpgqrvtiscsgsdsnigrrsvnwyqqfpgtapklliysndqrpsvvpd
rfsgsksgtsaslaisglqsedeaeyycaawddslkgavfgggtqltvlg
Timeline for d4fqil1:
View in 3DDomains from other chains: (mouse over for more information) d4fqia1, d4fqia2, d4fqib1, d4fqib2 |