SCOP 1.69: Domain d1ae6h1: 1ae6 H:1-114

Lineage for d1ae6h1 (1ae6 H:1-114)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1ae6h1: 1ae6 H:1-114 [20211]
   Other proteins in same PDB: d1ae6h2, d1ae6l1, d1ae6l2
   part of Fab CTM01

Details for d1ae6h1

PDB Entry: 1ae6, 3 Å

PDB Description: igg-fab fragment of mouse monoclonal antibody ctm01

SCOP Domain Sequences for d1ae6h1:

Sequence; same for both SEQRES and ATOM records:

>d1ae6h1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qiqlqqsgpelvkpgasvkisckasgytftdyyinwmkqkpgqglewigwidpgsgntky
nekfkgkatltvdtssstaymqlssltsedtavyfcarekttyyyamdywgqgtsvtvsa
a

Timeline for d1ae6h1:

• d1ae6h1 first appeared (with stable ids) in SCOP 1.55
  
• d1ae6h1 appears in SCOP 1.67
  
• d1ae6h1 appears in SCOP 1.71
  
• d1ae6h1 appears in the current release, SCOPe 2.08