![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab CTM01 (mouse), kappa L chain [48841] (1 PDB entry) |
![]() | Domain d1ae6h1: 1ae6 H:1-114 [20211] Other proteins in same PDB: d1ae6h2, d1ae6l2 |
PDB Entry: 1ae6 (more details), 3 Å
SCOP Domain Sequences for d1ae6h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ae6h1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab CTM01 (mouse), kappa L chain} qiqlqqsgpelvkpgasvkisckasgytftdyyinwmkqkpgqglewigwidpgsgntky nekfkgkatltvdtssstaymqlssltsedtavyfcarekttyyyamdywgqgtsvtvsa a
Timeline for d1ae6h1: