Lineage for d4fpig_ (4fpi G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1414208Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1414571Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1414572Protein automated matches [190081] (17 species)
    not a true protein
  7. 1414646Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries)
  8. 1414707Domain d4fpig_: 4fpi G: [202099]
    automated match to d4fpie_

Details for d4fpig_

PDB Entry: 4fpi (more details), 2.2 Å

PDB Description: Crystal Structure of 5-chloromuconolactone isomerase from Rhodococcus opacus 1CP
PDB Compounds: (G:) 5-chloromuconolactone dehalogenase

SCOPe Domain Sequences for d4fpig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fpig_ d.58.4.0 (G:) automated matches {Rhodococcus opacus [TaxId: 37919]}
mlylvrmtvnlprnldsreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns
hdelheilwslpffpyltidveplshhparvgkd

SCOPe Domain Coordinates for d4fpig_:

Click to download the PDB-style file with coordinates for d4fpig_.
(The format of our PDB-style files is described here.)

Timeline for d4fpig_: