![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
![]() | Protein automated matches [190081] (33 species) not a true protein |
![]() | Species Rhodococcus opacus [TaxId:37919] [196895] (4 PDB entries) |
![]() | Domain d4fpid_: 4fpi D: [202097] automated match to d4fpie_ |
PDB Entry: 4fpi (more details), 2.2 Å
SCOPe Domain Sequences for d4fpid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fpid_ d.58.4.0 (D:) automated matches {Rhodococcus opacus [TaxId: 37919]} mlylvrmtvnlprnldsreeerlkasekarsrtlqeqgqwrylwrttgkygnisvfdvns hdelheilwslpffpyltidveplshhparvgkd
Timeline for d4fpid_: