Lineage for d4folc_ (4fol C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135982Family c.69.1.34: Hypothetical esterase YJL068C [117714] (2 protein domains)
    part of Pfam PF00756
  6. 2135989Protein automated matches [190952] (2 species)
    not a true protein
  7. 2135990Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [193535] (1 PDB entry)
  8. 2135993Domain d4folc_: 4fol C: [202094]
    automated match to d4fola_

Details for d4folc_

PDB Entry: 4fol (more details), 2.07 Å

PDB Description: S-formylglutathione hydrolase Variant H160I
PDB Compounds: (C:) S-formylglutathione hydrolase

SCOPe Domain Sequences for d4folc_:

Sequence, based on SEQRES records: (download)

>d4folc_ c.69.1.34 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkvvkefsvcggrliklshnsnstktsmnvniylpkhyyaqdfprnkriptvfylsgltc
tpdnasekafwqfqadkygfaivfpdtsprgdevandpegswdfgqgagfylnatqepya
qhyqmydyihkelpqtldshfnkngdvkldfldnvaitgismggygaicgylkgysgkry
kscsafapivnpsnvpwgqkafkgylgeekaqweaydpclliknirhvgddrilihvgds
dpfleehlkpellleavkatswqdyveikkvhgfdhsyyfvstfvpehaefharnlgli

Sequence, based on observed residues (ATOM records): (download)

>d4folc_ c.69.1.34 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkvvkefsvcggrliklshnsnstktsmnvniylpkhyyaqriptvfylsgltctpdnas
ekafwqfqadkygfaivfpdtsprgdevandpegswdfgqgagfylnatqepyaqhyqmy
dyihkelpqtldshfnldfldnvaitgismggygaicgylkgysgkrykscsafapivnp
snvpwgqkafkgylgweaydpclliknirhvgddrilihvgdsdpfleehlkpellleav
katswqdyveikkvhgfdhsyyfvstfvpehaefharnlgli

SCOPe Domain Coordinates for d4folc_:

Click to download the PDB-style file with coordinates for d4folc_.
(The format of our PDB-style files is described here.)

Timeline for d4folc_: