Lineage for d4fo2t_ (4fo2 T:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058912Protein automated matches [190381] (8 species)
    not a true protein
  7. 2058935Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)
  8. 2058960Domain d4fo2t_: 4fo2 T: [202092]
    automated match to d4fo2j_
    complexed with act, na; mutant

Details for d4fo2t_

PDB Entry: 4fo2 (more details), 1.5 Å

PDB Description: Heat-labile enterotoxin LT-IIb-B5(T13I) mutant
PDB Compounds: (T:) Heat-labile enterotoxin IIB, B chain

SCOPe Domain Sequences for d4fo2t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fo2t_ b.40.2.1 (T:) automated matches {Escherichia coli [TaxId: 562]}
gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

SCOPe Domain Coordinates for d4fo2t_:

Click to download the PDB-style file with coordinates for d4fo2t_.
(The format of our PDB-style files is described here.)

Timeline for d4fo2t_: