Lineage for d4fo2s_ (4fo2 S:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1313713Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1314172Protein automated matches [190381] (4 species)
    not a true protein
  7. 1314195Species Escherichia coli [TaxId:562] [187229] (6 PDB entries)
  8. 1314219Domain d4fo2s_: 4fo2 S: [202091]
    automated match to d4fo2j_
    complexed with act, na; mutant

Details for d4fo2s_

PDB Entry: 4fo2 (more details), 1.5 Å

PDB Description: Heat-labile enterotoxin LT-IIb-B5(T13I) mutant
PDB Compounds: (S:) Heat-labile enterotoxin IIB, B chain

SCOPe Domain Sequences for d4fo2s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fo2s_ b.40.2.1 (S:) automated matches {Escherichia coli [TaxId: 562]}
gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

SCOPe Domain Coordinates for d4fo2s_:

Click to download the PDB-style file with coordinates for d4fo2s_.
(The format of our PDB-style files is described here.)

Timeline for d4fo2s_: