Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries) |
Domain d1qleh_: 1qle H: [20209] Other proteins in same PDB: d1qlea1, d1qleb1, d1qleb2, d1qlec1, d1qled1 |
PDB Entry: 1qle (more details), 3 Å
SCOP Domain Sequences for d1qleh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qleh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain} evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssa
Timeline for d1qleh_: