![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein automated matches [190381] (11 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187229] (8 PDB entries) |
![]() | Domain d4fo2i_: 4fo2 I: [202082] automated match to d4fo2j_ complexed with act, na; mutant |
PDB Entry: 4fo2 (more details), 1.5 Å
SCOPe Domain Sequences for d4fo2i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fo2i_ b.40.2.1 (I:) automated matches {Escherichia coli [TaxId: 562]} gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm taemrkiamaavlsgmrvnmcaspasspnviwaielea
Timeline for d4fo2i_: