Lineage for d4fo2i_ (4fo2 I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788746Protein automated matches [190381] (11 species)
    not a true protein
  7. 2788786Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)
  8. 2788795Domain d4fo2i_: 4fo2 I: [202082]
    automated match to d4fo2j_
    complexed with act, na; mutant

Details for d4fo2i_

PDB Entry: 4fo2 (more details), 1.5 Å

PDB Description: Heat-labile enterotoxin LT-IIb-B5(T13I) mutant
PDB Compounds: (I:) Heat-labile enterotoxin IIB, B chain

SCOPe Domain Sequences for d4fo2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fo2i_ b.40.2.1 (I:) automated matches {Escherichia coli [TaxId: 562]}
gasqffkdncnritaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlsgmrvnmcaspasspnviwaielea

SCOPe Domain Coordinates for d4fo2i_:

Click to download the PDB-style file with coordinates for d4fo2i_.
(The format of our PDB-style files is described here.)

Timeline for d4fo2i_: