Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries) |
Domain d1qlel_: 1qle L: [20208] Other proteins in same PDB: d1qlea1, d1qleb1, d1qleb2, d1qlec1, d1qled1 |
PDB Entry: 1qle (more details), 3 Å
SCOP Domain Sequences for d1qlel_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlel_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain} dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik
Timeline for d1qlel_: