Lineage for d1qlel_ (1qle L:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52579Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries)
  8. 52583Domain d1qlel_: 1qle L: [20208]
    Other proteins in same PDB: d1qlea1, d1qleb1, d1qleb2, d1qlec1, d1qled1

Details for d1qlel_

PDB Entry: 1qle (more details), 3 Å

PDB Description: cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment

SCOP Domain Sequences for d1qlel_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlel_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik

SCOP Domain Coordinates for d1qlel_:

Click to download the PDB-style file with coordinates for d1qlel_.
(The format of our PDB-style files is described here.)

Timeline for d1qlel_: