SCOP 1.69: Domain d1ar1c_: 1ar1 C:

Lineage for d1ar1c_ (1ar1 C:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)

8. Domain d1ar1c_: 1ar1 C: [20207]
   Other proteins in same PDB: d1ar1a_, d1ar1b1, d1ar1b2, d1ar1d_
   part of Fv against Paracoccus denitrificans cytochrome c oxidase

Details for d1ar1c_

PDB Entry: 1ar1, 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1c_:

Sequence; same for both SEQRES and ATOM records:

>d1ar1c_ b.1.1.1 (C:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvss

Timeline for d1ar1c_:

• d1ar1c_ first appeared (with stable ids) in SCOP 1.55
  
• d1ar1c_ appears in SCOP 1.67
  
• d1ar1c_ appears in SCOP 1.71
  
• d1ar1c_ appears in the current release, SCOPe 2.08