Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (8 species) not a true protein |
Species Escherichia coli [TaxId:562] [187229] (7 PDB entries) |
Domain d4fnff_: 4fnf F: [202069] automated match to d4fnfe_ complexed with act; mutant |
PDB Entry: 4fnf (more details), 1.75 Å
SCOPe Domain Sequences for d4fnff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fnff_ b.40.2.1 (F:) automated matches {Escherichia coli [TaxId: 562]} gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm taemrkiamaavldgmrvnmcaspasspnviwaielea
Timeline for d4fnff_: