Lineage for d4fnfd_ (4fnf D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381771Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2381772Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2382264Protein automated matches [190381] (10 species)
    not a true protein
  7. 2382287Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)
  8. 2382316Domain d4fnfd_: 4fnf D: [202068]
    automated match to d4fnfe_
    complexed with act; mutant

Details for d4fnfd_

PDB Entry: 4fnf (more details), 1.75 Å

PDB Description: LT-IIB-B5 S74D mutant
PDB Compounds: (D:) Heat-labile enterotoxin IIB, B chain

SCOPe Domain Sequences for d4fnfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fnfd_ b.40.2.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavldgmrvnmcaspasspnviwaielea

SCOPe Domain Coordinates for d4fnfd_:

Click to download the PDB-style file with coordinates for d4fnfd_.
(The format of our PDB-style files is described here.)

Timeline for d4fnfd_: