Lineage for d4fnfa_ (4fnf A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058912Protein automated matches [190381] (8 species)
    not a true protein
  7. 2058935Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)
  8. 2058961Domain d4fnfa_: 4fnf A: [202065]
    automated match to d4fnfe_
    complexed with act; mutant

Details for d4fnfa_

PDB Entry: 4fnf (more details), 1.75 Å

PDB Description: LT-IIB-B5 S74D mutant
PDB Compounds: (A:) Heat-labile enterotoxin IIB, B chain

SCOPe Domain Sequences for d4fnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fnfa_ b.40.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavldgmrvnmcaspasspnviwaielea

SCOPe Domain Coordinates for d4fnfa_:

Click to download the PDB-style file with coordinates for d4fnfa_.
(The format of our PDB-style files is described here.)

Timeline for d4fnfa_: