Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (4 species) not a true protein |
Species Comamonas testosteroni [TaxId:285] [193572] (4 PDB entries) |
Domain d4fm4n_: 4fm4 N: [202058] Other proteins in same PDB: d4fm4a_, d4fm4c_, d4fm4e_, d4fm4g_, d4fm4i_, d4fm4k_, d4fm4m_, d4fm4o_ automated match to d4fm4j_ complexed with fe, po4 |
PDB Entry: 4fm4 (more details), 2.38 Å
SCOPe Domain Sequences for d4fm4n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fm4n_ b.34.4.0 (N:) automated matches {Comamonas testosteroni [TaxId: 285]} mdgmhdlggkqgfgpvikthnakafheewevkmnaisgalvskgiynmdeyrhgiermep rhyltasyfervfttavtlciekgvftaaeleaklgtsvplslpsspgrqpakgpeggfk lgqrvhvknefvpghtrfpayirgkagvvvgispaypypdaaahgeygfseptydvcfks kdlwpdgceaadvhvgvfqsyllsae
Timeline for d4fm4n_: